PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy020821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 226aa    MW: 25402.5 Da    PI: 5.5334
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59544017PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.51.2e-32142198258
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                dDgy+WrKYGqK++k+s++prsYYrCt ++C++kk+vers+edp++++itYeg H h
  Ahy020821 142 DDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCSAKKQVERSNEDPDTLIITYEGLHLH 198
                8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081127.278136201IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.5E-30139198IPR003657WRKY domain
SuperFamilySSF1182905.75E-27139198IPR003657WRKY domain
SMARTSM007742.1E-35141200IPR003657WRKY domain
PfamPF031062.7E-26142198IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
XMMEEEVILM SSNSNSNSNS NSSCSEGSED DDLVKELLDD ATPLLLPPSD HYNTIIRPPP  60
SDGDGDDYDH AINSFISNIY SGPTISDFEN ALSVINNSNN HQSDQHLEHL SSARVSILER  120
GLSKIENKYT LKFKCFGNGM GDDGYKWRKY GQKSIKNSPN PRSYYRCTNP RCSAKKQVER  180
SNEDPDTLII TYEGLHLHFA YPHFLTGQPH QSQSDPPIKK PKPMPX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-211421981874Probable WRKY transcription factor 4
2ayd_A3e-211421981571WRKY transcription factor 1
2lex_A3e-211421981874Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015960810.11e-144PREDICTED: probable WRKY transcription factor 49
TrEMBLA0A0B2S7Q51e-106A0A0B2S7Q5_GLYSO; Putative WRKY transcription factor 49
TrEMBLK7L1H51e-106K7L1H5_SOYBN; Uncharacterized protein
STRINGGLYMA07G16040.21e-105(Glycine max)